Iright
BRAND / VENDOR: Proteintech

Proteintech, 86452-1-RR, FOXK1 Recombinant monoclonal antibody

CATALOG NUMBER: 86452-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FOXK1 (86452-1-RR) by Proteintech is a Recombinant antibody targeting FOXK1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86452-1-RR targets FOXK1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, HEK-293T cells, Jurkat cells, K-562 cells, NIH/3T3 cells, PC-12 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Forkhead box (FOX) domains bind DNA and consist of 2 loops connecting beta-sheets that flank an alpha-helix, which is a group of highly conserved transcription factors. Forkhead box k1 (FOXK1) also known as MNF, is a transcription factor that belongs to the forkhead family consisting of the winged-helix DNA-binding domain and the N-terminal and C-terminal transcriptional domains(PMID: 15289879, PMID: 27223064). There are two isoforms of FoxK1: FoxK1-α and FoxK1-β. FoxK1-α (90 kDa) is expressed in committed myoblasts and differentiated myotubes, while FoxK1-β (55 kDa) is expressed mainly in quiescent satellite cells(PMID: 9271401). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28820 Product name: Recombinant human FOXK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001037165 Sequence: MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPPGPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ Predict reactive species Full Name: forkhead box K1 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: NM_001037165 Gene Symbol: FOXK1 Gene ID (NCBI): 221937 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P85037 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924