Iright
BRAND / VENDOR: Proteintech

Proteintech, 86488-1-RR, SECISBP2 Recombinant monoclonal antibody

CATALOG NUMBER: 86488-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SECISBP2 (86488-1-RR) by Proteintech is a Recombinant antibody targeting SECISBP2 in WB, ELISA applications with reactivity to human samples 86488-1-RR targets SECISBP2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells, HEK-293 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information SECISBP2 (also called SECIS-binding protein 2 or SBP2) is an RNA-binding protein that serves as the master regulator of selenoprotein synthesis in eukaryotes. It recognizes and binds the SECIS (SEC Insertion Sequence) stem-loop structure located in the 3′-UTR of all selenoprotein mRNAs, thereby converting the otherwise stop-coding UGA triplet into the 21st amino acid selenocysteine (Sec) during translation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3541 Product name: Recombinant human SECISBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 506-854 aa of BC036109 Sequence: NPLDSSAPLMKKGKQREIPKAKKPTSLKKIILKERQERKQRLQENAVGPAFTSDDTQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKSEEPPGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLGLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWKKHLEAYSGCTLELEESLEASTSQMMNLNL Predict reactive species Full Name: SECIS binding protein 2 Calculated Molecular Weight: 854 aa, 95 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC036109 Gene Symbol: SECISBP2 Gene ID (NCBI): 79048 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96T21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924