Iright
BRAND / VENDOR: Proteintech

Proteintech, 86505-1-RR, ALPI Recombinant monoclonal antibody

CATALOG NUMBER: 86505-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ALPI (86505-1-RR) by Proteintech is a Recombinant antibody targeting ALPI in WB, ELISA applications with reactivity to human, mouse, rat samples 86505-1-RR targets ALPI in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Intestinal-type alkaline phosphatase (IAP) is one of the four human alkaline-phosphatase isoenzymes. It is synthesized by enterocytes of the small-intestinal brush border and is released into the gut lumen, blood and stool. Intestinal-type alkaline phosphatase is a constitutive, evolutionarily conserved sentinel that chemically disarms microbial toxins, orchestrates innate immunity and preserves gut homeostasis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3033 Product name: recombinant human ALPI protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-528 aa of NM_001631.5 Sequence: VIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLGDGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLCGVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADASQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRDPTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERAGQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVFNSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHVMAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP Predict reactive species Full Name: alkaline phosphatase, intestinal Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: NM_001631.5 Gene Symbol: ALPI Gene ID (NCBI): 248 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09923 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924