Iright
BRAND / VENDOR: Proteintech

Proteintech, 86518-1-RR, ALDH1A2 Recombinant monoclonal antibody

CATALOG NUMBER: 86518-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ALDH1A2 (86518-1-RR) by Proteintech is a Recombinant antibody targeting ALDH1A2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86518-1-RR targets ALDH1A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse spleen tissue, rat spleen tissue, mouse testis tissue, rat testis tissue, human testis Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information ALDH1A2(aldehyde dehydrogenase family 1 member A2) is also named as RALDH2(retinal dehydrogenase 2) and belongs to the aldehyde dehydrogenase family. It is a cytosolic homotetramer(56.7 kDa subunits) exhibiting complex expression patterns throughout embryonic development. ALDH1A2 plays a role in retinoid metabolism during embryonic development where it is considered to be the major retinoic acid-synthesizing enzyme during early embryogenesis(PMID:20735668). Its expression is reduced in primary prostate tumors compared with normal prostate tissue suggested that it is normally expressed in the epithelial compartment of prostate tissue(PMID:16166285).It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5062 Product name: Recombinant human ALDH1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-481 aa of BC030589 Sequence: GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS Predict reactive species Full Name: aldehyde dehydrogenase 1 family, member A2 Calculated Molecular Weight: 518 aa, 57 kDa Observed Molecular Weight: 53-57 kDa GenBank Accession Number: BC030589 Gene Symbol: ALDH1A2 Gene ID (NCBI): 8854 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O94788 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924