Iright
BRAND / VENDOR: Proteintech

Proteintech, 86530-1-RR, SAMD4A Recombinant monoclonal antibody

CATALOG NUMBER: 86530-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SAMD4A (86530-1-RR) by Proteintech is a Recombinant antibody targeting SAMD4A in WB, ELISA applications with reactivity to human, mouse, rat samples 86530-1-RR targets SAMD4A in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SAMD4A is also named as KIAA1053, SAMD4, SMAUG1, hSmaug1 and belongs to the SMAUG family. SAMD4A acts as a translational repressor of SRE-containing messengers. (PMID:16221671). In particular, as orthologous alternative splicing isoforms, mouse Samd4a E-form and human SAMD4A C-form containing the SAM domain were specific to testes. Samd4a/SAMD4A plays an essential role in normal spermatogenesis, and SAMD4A, as a spermatid specific marker, can be used for subcategorizing nonobstructive azoospermia patients (PMID:36274854). In mammalian cells, human SAMD4A can form a kind of mRNA‐silencing foci in the cytoplasm, acting differently from processing body and stress granules. Recently, it was reported that human SAMD4A can protect the host from viral infection by degrading viral RNA (PMID: 32341522). Indition, 14-3-3s negatively regulate the localization of the RNA-binding protein SAMD4A to cytoplasmic granules and inhibit its activity as a translational repressor (PMID: 36931259). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11273 Product name: Recombinant human SAMD4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-383 aa of BC021726 Sequence: LLNPYQAAAWDSICPIHWRLTDIIEGGSLRIPLQELHQMILTPIKAYSSPSTTPEARRREPQAPRQPSLMGPESQSPDCKDGAAATGATATPSAGASGGLQPHQLSSCDGELAVAPLPEGDLPGQFTRVMGKVCTQLLVSRPDEENISSYLQLIDKCLIHEAFTETQKKRLLSWKQQVQKLFRSFPRKTLLDISGYRQQRNRGFGQSNSLPTAGSVGGGMGRRNPRQYQIPSRNVPSARLGLLGTSGFVSSNQRNTTATPTIMKQGRQNLWFANPGGSNSMPSRTHSSVQRTRSLPVHTSPQNMLMFQQPGSQVHSGLCLTDLRGWLSLSGAPSMPALTVPKSSQGEFQLPVTEPDINNRLESLCLSMTEHALGDGVDRTSTI Predict reactive species Full Name: sterile alpha motif domain containing 4A Calculated Molecular Weight: 529 aa, 59 kDa Observed Molecular Weight: 70-71 kDa GenBank Accession Number: BC021726 Gene Symbol: SAMD4A Gene ID (NCBI): 23034 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UPU9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924