Proteintech, 86534-2-RR, LOXL1 Recombinant monoclonal antibody

Size: 20ul / 100ul The LOXL1 (86534-2-RR) by Proteintech is a Recombinant antibody targeting LOXL1 in WB, IF/ICC, ELISA applications with reactivity to human samples 86534-2-RR targets LOXL1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, MG-63 cells, PC-3 cells, U-87 MG cells Positive IF/ICC detected in: U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Three LOXL1 variants are seen: a band of 64 kDa matching the predicted full-length form lacking the secretory signal peptide, a band of 67 kDa presumed to be the full-length form with the signal peptide, and a band of 36 kDa matching the cleavage product. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24293 Product name: Recombinant human LOXL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-366 aa of BC015090 Sequence: TPGFEQAYPDPGPEAAQAHGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVYRPNQNG Predict reactive species Full Name: lysyl oxidase-like 1 Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 60-63 kDa GenBank Accession Number: BC015090 Gene Symbol: LOXL1 Gene ID (NCBI): 4016 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.