Iright
BRAND / VENDOR: Proteintech

Proteintech, 86540-5-RR, RAB8A Recombinant monoclonal antibody

CATALOG NUMBER: 86540-5-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAB8A (86540-5-RR) by Proteintech is a Recombinant antibody targeting RAB8A in WB, ELISA applications with reactivity to human samples 86540-5-RR targets RAB8A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, HepG2 cells, fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information The Rab8 GTPase is a member of the Ras superfamily that functions in protein transport and membrane restructuring. RAB8 has two isoforms, RAB8A and RAB8B, that share 40% amino acid identity in the C-terminal variable region. RAB8 activity is regulated by specific guanine nucleotide exchange factors (GEFs), that mediate GTP loading, and GTPase activating proteins (GAPs) that convert them into the inactive GDP-bound form. RAB8 participates in recycling of the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors to the dendritic spine surface as well as in the intracellular transport of the metabotropic glutamate receptor type 1 in neuronal cells. Rab8 is activated at the base of the cilium by its guanine nucleotide exchanger Rabin8. The antibody 11792-1-AP can detect both RAB8A and RAB8B. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30567 Product name: Recombinant human RAB8A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-204 aa of NM_005370 Sequence: TSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRC Predict reactive species Full Name: RAB8A, member RAS oncogene family Calculated Molecular Weight: 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: NM_005370 Gene Symbol: RAB8A Gene ID (NCBI): 4218 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61006 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924