Iright
BRAND / VENDOR: Proteintech

Proteintech, 86561-1-RR, RCAN2 Recombinant monoclonal antibody

CATALOG NUMBER: 86561-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RCAN2 (86561-1-RR) by Proteintech is a Recombinant antibody targeting RCAN2 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 86561-1-RR targets RCAN2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3597 Product name: Recombinant human RCAN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-201 aa of BC038509 Sequence: LFRTYDDCVTFQLFKSFRRVRINFSNPKSAARARIELHETQFRGKKLKLYFAQVQTPETDGDKLHLAPPQPAKQFLISPPSSPPVGWQPINDATPVLNYDLLYAVAKLGPGEKYELHAGTESTPSVVVHVCDSDIEEEEDPKTSPKPKIIQTRRPGLPPSVSNWAAC Predict reactive species Full Name: regulator of calcineurin 2 Calculated Molecular Weight: 225 aa, 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC038509 Gene Symbol: RCAN2 Gene ID (NCBI): 10231 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924