Iright
BRAND / VENDOR: Proteintech

Proteintech, 86601-3-RR, STAMBP Recombinant monoclonal antibody

CATALOG NUMBER: 86601-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The STAMBP (86601-3-RR) by Proteintech is a Recombinant antibody targeting STAMBP in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86601-3-RR targets STAMBP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, NIH/3T3 cells, rat brain tissue, Jurkat cells, SW480 cells, K-562 cells, mouse brain tissue Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information STAM-binding protein (STAMBP) is also named AMSH. STAMBP, a member of the Jab1/MPN metalloenzyme family of deubiquitinating enzymes (DUBs), specifically cleaves K63-linked polyubiquitination chains from substrates (PMID: 15314065, PMID: 26601948). STAMBP is implicated in the endosome-lysosome pathway and shuttles ubiquitinated substrate proteins to lysosomes for degradation (PMID: 10383417, PMID: 24151880). STAMBP regulates protein degradation by binding to the ESCRT-0 protein STAM and the charged multivesicular body proteins of the ESCRT-III complex (PMID: 20159979). STAMBP is implicated in the inflammatory response by promoting the deubiquitination and stabilization of NALP7 and increasing the activity of inflammasomes (PMID: 28492230). STAMBP expression was increased in the cytoplasm of tumor cells from LUAD patients. STAMBP overexpression promoted cell migration and invasion, whereas STAMBP knockdown attenuated these processes in LUAD cells after epidermal growth factor treatment (PMID: 3410245). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1895 Product name: Recombinant human STAMBP protein Source: e coli. -derived, PKG Tag: GST Domain: 124-424 aa of BC007682 Sequence: EKKKEAEELARNMAIQQELEKEKQRVAQQKQQQLEQEQFHAFEEMIRNQELEKERLKIVQEFGKVDPGLGGPLVPDLEKPSLDVFPTLTVSSIQPSDCHTTVRPAKPPVVDRSLKPGALSNSESIPTIDGLRHVVVPGRLCPQFLQLASANTARGVETCGILCGKLMRNEFTITHVLIPKQSAGSDYCNTENEEELFLIQDQQGLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLPESVAIVCSPKFQETGFFKLTDHGLEEISSCRQKGFHPHSKDPPLFCSCSHVTVVDRAVTITDLR Predict reactive species Full Name: STAM binding protein Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC007682 Gene Symbol: STAMBP Gene ID (NCBI): 10617 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95630 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924