Iright
BRAND / VENDOR: Proteintech

Proteintech, 86607-3-RR, CCL20/MIP-3 alpha Recombinant monoclonal antibody

CATALOG NUMBER: 86607-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CCL20/MIP-3 alpha (86607-3-RR) by Proteintech is a Recombinant antibody targeting CCL20/MIP-3 alpha in WB, IHC, ELISA applications with reactivity to rat samples 86607-3-RR targets CCL20/MIP-3 alpha in WB, IHC, ELISA applications and shows reactivity with rat samples. Tested Applications Positive WB detected in: Transfected with Rat CCL20/MIP-3 alpha HEK-293T cells Positive IHC detected in: rat liver tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information CCL20, also known as macrophage infiltrating factor protein 3α, is a C-C chemokine that specifically binds to the receptor CCR6. CCL20 is produced in various tissues and by a wide range of immune cells, including neutrophils, natural killer cells, T-helper type 17 (Th17) cells, B cells, and various antigen-presenting cells, such as dendritic cells (DCs), Langerhans cells, and macrophages. Increased expression of CCL20 is likely involved in the increased recruitment of dendritic cells observed in fibroinflammatory diseases such as chronic obstructive pulmonary disease (COPD). CCL20 expression is increased by the proinflammatory cytokine IL-1 beta. Specification Tested Reactivity: rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3237 Product name: Recombinant Rat CCL20/MIP-3 alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 27-96 aa of NM_019233.1 Sequence: SNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM Predict reactive species Full Name: chemokine (C-C motif) ligand 20 Calculated Molecular Weight: 11 kDa GenBank Accession Number: NM_019233.1 Gene Symbol: Ccl20 Gene ID (NCBI): 29538 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P97884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924