Iright
BRAND / VENDOR: Proteintech

Proteintech, 86615-3-RR, MASP1 Recombinant monoclonal antibody

CATALOG NUMBER: 86615-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MASP1 (86615-3-RR) by Proteintech is a Recombinant antibody targeting MASP1 in WB, ELISA applications with reactivity to mouse samples 86615-3-RR targets MASP1 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse serum Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information MASP1, also known as CRARF, is a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The lectin pathway is triggered upon binding of mannan-binding lectin (MBL) and ficolins to sugar moieties, which leads to activation of the associated proteases MASP1 and MASP2. The observed molecular weight of 90 kDa is consistent with the values described in the literature (PMID: 24472859, 12396007). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4420 Product name: Recombinant Mouse Masp1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 300-445 aa of NM_008555.2 Sequence: RAAGNECPKLQPPVYGKIEPSQAVYSFKDQVLVSCDTGYKVLKDNEVMDTFQIECLKDGAWSNKIPTCKIVDCGAPAGLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCSAHGTWTNEVLKRSLPTCLPVCGVPK Predict reactive species Full Name: mannan-binding lectin serine peptidase 1 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: NM_008555.2 Gene Symbol: Masp1 Gene ID (NCBI): 17174 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P98064-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924