Iright
BRAND / VENDOR: Proteintech

Proteintech, 86630-3-RR, Importin Beta Recombinant monoclonal antibody

CATALOG NUMBER: 86630-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Importin Beta (86630-3-RR) by Proteintech is a Recombinant antibody targeting Importin Beta in WB, ELISA applications with reactivity to human, mouse, rat samples 86630-3-RR targets Importin Beta in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A2780 cells, HeLa cells, HT-1080 cells, NIH/3T3 cells, C6 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Importin beta1, also known karyopherin beta or KPNB1, is a nuclear transport receptor that plays a key role in the nuclear import process. Importin beta1 and importin alpha work in concert to transport cargo into the nucleus, functioning as an essential component of the classical nuclear localization signal (NLS) pathway. Elevated expression of importin beta1 has been found in cervical tumors. (22125623) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0122 Product name: Recombinant human KPNB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 409-612 aa of BC003572 Sequence: AMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLL Predict reactive species Full Name: karyopherin (importin) beta 1 Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 90-97 kDa GenBank Accession Number: BC003572 Gene Symbol: KPNB1 Gene ID (NCBI): 3837 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14974 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924