Proteintech, 86635-1-RR, SLC25A24 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC25A24 (86635-1-RR) by Proteintech is a Recombinant antibody targeting SLC25A24 in WB, ELISA applications with reactivity to human, mouse, rat samples 86635-1-RR targets SLC25A24 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, BxPC-3 cells, HT-29 cells, U-251 cells, NIH/3T3 cells, mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SLC25A24 (solute carrier family 25 member 24) is a gene encoding a mitochondrial ATP-Mg/phosphate transporter. It belongs to the mitochondrial carrier protein family and is mainly involved in mitochondrial energy metabolism and calcium signal regulation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6334 Product name: Recombinant human SLC25A24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 128-477 aa of BC068561 Sequence: ELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC068561 Gene Symbol: SLC25A24 Gene ID (NCBI): 29957 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6NUK1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.