Iright
BRAND / VENDOR: Proteintech

Proteintech, 86660-3-RR, CLTC Recombinant monoclonal antibody

CATALOG NUMBER: 86660-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CLTC (86660-3-RR) by Proteintech is a Recombinant antibody targeting CLTC in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 86660-3-RR targets CLTC in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, Raji cells, mouse brain tissue, rat brain tissue, pig brain tissue Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25041 Product name: Recombinant human CLTC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC054489 Sequence: MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRM Predict reactive species Full Name: clathrin, heavy chain (Hc) Calculated Molecular Weight: 192 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC054489 Gene Symbol: CLTC Gene ID (NCBI): 1213 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q00610 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924