Iright
BRAND / VENDOR: Proteintech

Proteintech, 86668-2-RR, SMN Recombinant monoclonal antibody

CATALOG NUMBER: 86668-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SMN (86668-2-RR) by Proteintech is a Recombinant antibody targeting SMN in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 86668-2-RR targets SMN in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, K-562 cells, U-87 MG cells, SH-SY5Y cells, mouse testis tissue, rat brain tissue Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Spinal muscular atrophy (SMA) is an autosomal recessive neurodegenerative disease characterized by loss of anterior horn cells in the spinal cord and concomitant symmetrical muscle weakness and atrophy (PMID: 16364894 ). SMA is caused by deletion or mutations of the survival motor neuron (SMN1) gene. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional (PMID: 17355180). A large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein (PMID: 10369862). The level of SMN protein correlates with phenotypic severity of SMA. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4812 Product name: Recombinant Human SMN2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 90-151 aa of BC015308 Sequence: QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANN Predict reactive species Full Name: survival of motor neuron 2, centromeric Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC015308 Gene Symbol: SMN Gene ID (NCBI): 6607 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16637 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924