Proteintech, 86688-1-RR, ERCC6L Recombinant monoclonal antibody

Size: 20ul / 100ul The ERCC6L (86688-1-RR) by Proteintech is a Recombinant antibody targeting ERCC6L in WB, IP, ELISA applications with reactivity to human samples 86688-1-RR targets ERCC6L in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, Jurkat cells Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information ERCC6L, also named as Tumor antigen BJ-HCC-15 or PICH, is a 1250 amino acid protein, which contains one helicase ATP-binding domain, one helicase C-terminal domain and two TPR repeats. ERCC6L localizes to kinetochores, inner centromeres and belongs to the SNF2/RAD54 helicase family. ERCC6L as a DNA helicase that acts as an essential component of the spindle assembly checkpoint. The calculated molecular weight of ERCC6L is 140 kDa, but the phosphorylated modification of molecular weight of ERCC6L is about 180kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8223 Product name: Recombinant human ERCC6L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-454 aa of BC008808 Sequence: NAESNVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN Predict reactive species Full Name: excision repair cross-complementing rodent repair deficiency, complementation group 6-like Calculated Molecular Weight: 419 aa, 46 kDa, 141 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC008808 Gene Symbol: ERCC6L Gene ID (NCBI): 54821 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q2NKX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.