Iright
BRAND / VENDOR: Proteintech

Proteintech, 86704-1-RR, HURP Recombinant monoclonal antibody

CATALOG NUMBER: 86704-1-RR
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HURP (86704-1-RR) by Proteintech is a Recombinant antibody targeting HURP in WB, ELISA applications with reactivity to human samples 86704-1-RR targets HURP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, HEK-293 cells, A431 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2667 Product name: Recombinant human HURP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 498-847 aa of BC010658 Sequence: IKETTCTDLDGFWDMVSFQIEDVIHKFNNLIKLEESGWQVNNNMNHNMNKNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTECHLLDSPGLNCSNPFTQLERRHQEHARHISFGGNLITFSPLQPGEF Predict reactive species Full Name: discs, large (Drosophila) homolog-associated protein 5 Calculated Molecular Weight: 846 aa, 95 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC010658 Gene Symbol: HURP Gene ID (NCBI): 9787 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15398 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924