Iright
BRAND / VENDOR: Proteintech

Proteintech, 86712-3-RR, LIX1L Recombinant monoclonal antibody

CATALOG NUMBER: 86712-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The LIX1L (86712-3-RR) by Proteintech is a Recombinant antibody targeting LIX1L in WB, IP, ELISA applications with reactivity to human samples 86712-3-RR targets LIX1L in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, SH-SY5Y cells, K-562 cells, HL-60 cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Limb expression 1-like protein (LIX1L) is a putative RNA binding protein that contains a double-stranded RNA-binding motif. LIX1L is highly expressed in various cancer tissues. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22209 Product name: Recombinant human LIX1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC035727 Sequence: METMRAQRLQPGVGTSGRGTLRALRPGVTGAAAATATPPAGPPPAPPPPAPPPPPLLLSGAPGLPLPPGAAGSPAVLREAVEAVVRSFAKHTQGYGRVNVVE Predict reactive species Full Name: Lix1 homolog (mouse)-like Calculated Molecular Weight: 337 aa, 37 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC035727 Gene Symbol: LIX1L Gene ID (NCBI): 128077 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IVB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924