Iright
BRAND / VENDOR: Proteintech

Proteintech, 86714-3-RR, SOX9 Recombinant monoclonal antibody

CATALOG NUMBER: 86714-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SOX9 (86714-3-RR) by Proteintech is a Recombinant antibody targeting SOX9 in WB, ELISA applications with reactivity to human samples 86714-3-RR targets SOX9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BxPC-3 cells, SW480 cells, HCT 116 cells, HT-29 cells, NCCIT cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SOX9, also named as Transcription factor SOX-9, is a 509 amino acid protein. Sex-determining region Y (SRY)-box 9 protein (SOX9) is a member of the SOX family of transcription factors (TFs) which are developmental regulators that possess high mobility group (HMG) box DNA binding and transactivation domains. It participates in a variety of functions, such as lineage restriction and terminal diferentiation, through precise temporal and spatial expression patterns that difer between particular cell types and tissues. SOX9 gene has been implicated in different types of cancer as an oncogene; however, it also may behave as a tumor suppressor. SOX9 can be ubiquitinated or SUMOylated to higher molecular weight (PMID: 24155239; 16307912; 16554309; 32070068) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26274 Product name: Recombinant human SOX9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-405 aa of NM_000346 Sequence: MVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPPQAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPS Predict reactive species Full Name: SRY (sex determining region Y)-box 9 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: NM_000346 Gene Symbol: SOX9 Gene ID (NCBI): 6662 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48436 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924