Iright
BRAND / VENDOR: Proteintech

Proteintech, 86723-1-RR, MSI1 Recombinant monoclonal antibody

CATALOG NUMBER: 86723-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MSI1 (86723-1-RR) by Proteintech is a Recombinant antibody targeting MSI1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 86723-1-RR targets MSI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse brain tissue, SH-SY5Y cells, COLO 320 cells, Neuro-2a cells, PC-12 cells, rat brain tissue Positive IHC detected in: mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information Musashi1 (Msi1) is an RNA-binding protein expressed in neural progenitor cells and neural stem cells. The gene encoding human Msi1 encodes a 362 amino acid protein. In murine embryonic neural progenitor cells, Msi1 localizes to the cytoplasm and is downregulated during differentiation. Msi1 binds to NUMB, which encodes a membrane-associated antagonist of Notch signaling. Msi1 appears to function in the proliferation and maintenance of stem cell populations of the central nervous system. In addition to its usefulness as a marker for neural progenitor cells in normal human brains, Msi1 is also a marker for human gliomas. In rats, Msi1 is expressed in Sertoli cells of the testis and granulosa cells of the ovary. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26042 Product name: Recombinant human MSI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-83 aa of BC146463 Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRH Predict reactive species Full Name: musashi homolog 1 (Drosophila) Calculated Molecular Weight: 362 aa, 39 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC146463 Gene Symbol: MSI1 Gene ID (NCBI): 4440 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43347 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924