Iright
BRAND / VENDOR: Proteintech

Proteintech, 86799-1-RR, UPK1A Recombinant monoclonal antibody

CATALOG NUMBER: 86799-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The UPK1A (86799-1-RR) by Proteintech is a Recombinant antibody targeting UPK1A in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 86799-1-RR targets UPK1A in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse bladder tissue, rat bladder tissue Positive IF-P detected in: mouse bladder tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Uroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1a (UPK1A) belongs to the tetraspanin (TM4SF) family. UPK1A plays an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17356 Product name: Recombinant human UPK1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 111-230 aa of BC107098 Sequence: CITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYT Predict reactive species Full Name: uroplakin 1A Calculated Molecular Weight: 258 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC107098 Gene Symbol: UPK1A Gene ID (NCBI): 11045 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00322 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924