Iright
BRAND / VENDOR: Proteintech

Proteintech, 86804-1-RR, BDNF Recombinant monoclonal antibody

CATALOG NUMBER: 86804-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BDNF (86804-1-RR) by Proteintech is a Recombinant antibody targeting BDNF in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 86804-1-RR targets BDNF in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Neuro-2a cells, PC-12 cells, K-562 cells, rat brain tissue, mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information BDNF is a member of the family of neurotrophic factors. It was first explored and purified from pig brain in 1982, and other members of the neurotrophin family were successively discovered. BDNF is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of BDNF is reduced in both Alzheimer's and Huntington disease patients. It participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. It also plays a role in the regulation of stress response and in the biology of mood disorders. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3363 Product name: recombinant mouse BDNF protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 19-249 aa of NM_001048139.1 Sequence: APMKEVNVHGQGNMAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVAAHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR Predict reactive species Full Name: brain derived neurotrophic factor Calculated Molecular Weight: 28KD Observed Molecular Weight: 28 kDa GenBank Accession Number: NM_001048139.1 Gene Symbol: Bdnf Gene ID (NCBI): 12064 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P21237-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924