Proteintech, 86812-1-RR, iPLA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The iPLA2 (86812-1-RR) by Proteintech is a Recombinant antibody targeting iPLA2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86812-1-RR targets iPLA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information PLA2G6, also named as PLPLA9, iPLA2, is involved in the remodeling of membranes allowing arachidonic acid to be placed in the proper position in phospholipids for stimulated release. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36873 Product name: Recombinant human PLA2G6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-343 aa of BC036742 Sequence: MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLVNPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSWSVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMARMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANA Predict reactive species Full Name: phospholipase A2, group VI (cytosolic, calcium-independent) Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC036742 Gene Symbol: PLA2G6 Gene ID (NCBI): 8398 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60733 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.