Iright
BRAND / VENDOR: Proteintech

Proteintech, 86818-2-RR, COX6C Recombinant monoclonal antibody

CATALOG NUMBER: 86818-2-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The COX6C (86818-2-RR) by Proteintech is a Recombinant antibody targeting COX6C in WB, ELISA applications with reactivity to human, mouse, rat samples 86818-2-RR targets COX6C in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse heart tissue, A-673 cells, MCF-7 cells, SW480 cells, rat heart tissue, human heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Cytochrome c oxidase (COX) is the terminal oxidase in the respiratory chain in human and other mammalian cells. The enzyme is composed of 13 different subunits. COX6C(Cytochrome c oxidase subunit 6C) is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1982 Product name: Recombinant human COX6C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-75 aa of BC000187 Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK Predict reactive species Full Name: cytochrome c oxidase subunit VIc Calculated Molecular Weight: 75 aa, 9 kDa Observed Molecular Weight: 9 kDa GenBank Accession Number: BC000187 Gene Symbol: COX6C Gene ID (NCBI): 1345 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P09669 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924