Iright
BRAND / VENDOR: Proteintech

Proteintech, 86822-1-RR, ZFC3H1 Recombinant monoclonal antibody

CATALOG NUMBER: 86822-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ZFC3H1 (86822-1-RR) by Proteintech is a Recombinant antibody targeting ZFC3H1 in WB, ELISA applications with reactivity to human samples 86822-1-RR targets ZFC3H1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, U2OS cells, DU 145 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ZFC3H1, also known as CCDC131 and PSRC2, is a large protein (1989 amino acids), with a C3H1- type zinc finger motif in its center, and contains five tetratricopeptide (TRP) repeats and six halftetratricopeptide (HAT) repeats at the C-terminal region. It is involved in the processing of a variety of RNAs and plays a critical role in the degradation of nuclear RNAs (PMID: 34514952). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34224 Product name: Recombinant human ZFC3H1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1800-1989 aa of BC156732 Sequence: RNKVQEFKFFTDLVNRCLVTVPARYPIPFSSADYWSNYEFHNRVIFFYLSCVPKTQHSKTLERFCSVMPANSGLALRLLQHEWEESNVQILKLQAKMFTYNIPTCLATWKIAIAAEIVLKGQREVHRLYQRALQKLPLCASLWKDQLLFEASEGGKTDNLRKLVSKCQEIGVSLNELLNLNSNKTESKNH Predict reactive species Full Name: zinc finger, C3H1-type containing Calculated Molecular Weight: 226 kDa Observed Molecular Weight: 260 kDa GenBank Accession Number: BC156732 Gene Symbol: ZFC3H1 Gene ID (NCBI): 196441 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60293 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924