Iright
BRAND / VENDOR: Proteintech

Proteintech, 86827-4-RR, ANKRD46 Recombinant monoclonal antibody

CATALOG NUMBER: 86827-4-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The ANKRD46 (86827-4-RR) by Proteintech is a Recombinant antibody targeting ANKRD46 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 86827-4-RR targets ANKRD46 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, MDA-MB-231 cells,HepG2 cells, Jurkat cells, rat brain tissue Positive IF/ICC detected in: Jurkat cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information ANKRD46 encodes a protein containing multiple ankyrin repeats. Ankyrin domains function in protein-protein interactions in a variety of cellular processes. ANKRD46 also known as ankyrin repeat small protein (ANK-S), is a 228-amino acid single-pass membrane protein(PMID: 21219636). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag26623 Product name: Recombinant human ANKRD46 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC060843 Sequence: MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDICQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGVNKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFRTTWQEFVED Predict reactive species Full Name: ankyrin repeat domain 46 Observed Molecular Weight: 25 kDa GenBank Accession Number: BC060843 Gene Symbol: ANKRD46 Gene ID (NCBI): 157567 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86W74 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924