Iright
BRAND / VENDOR: Proteintech

Proteintech, 86828-1-RR, EFCAB1 Recombinant monoclonal antibody

CATALOG NUMBER: 86828-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The EFCAB1 (86828-1-RR) by Proteintech is a Recombinant antibody targeting EFCAB1 in WB, ELISA applications with reactivity to mouse, rat samples 86828-1-RR targets EFCAB1 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, L02 cells, mouse liver tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Background Information EFCAB1, also known as Calaxin, is a gene that encodes a protein involved in the function of cilia and flagella, which are hair-like structures protruding from the surface of certain cells. Research indicates that EFCAB1 overexpression inhibits cell proliferation, migration, and invasion while promoting apoptosis in lung adenocarcinoma cells. This suggests that EFCAB1 could potentially serve as a biomarker for lung adenocarcinoma. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11039 Product name: Recombinant human EFCAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-211 aa of BC025676 Sequence: MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM Predict reactive species Full Name: EF-hand calcium binding domain 1 Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 24 kDa, 18 kDa GenBank Accession Number: BC025676 Gene Symbol: EFCAB1 Gene ID (NCBI): 79645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9HAE3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924