Proteintech, 86851-1-RR, HBG1 Recombinant monoclonal antibody

Size: 20ul / 100ul The HBG1 (86851-1-RR) by Proteintech is a Recombinant antibody targeting HBG1 in WB, ELISA applications with reactivity to human samples 86851-1-RR targets HBG1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEL cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information HBG1, also named as Hb F Agamma, HBGA, HBGR and HSGGL, belongs to the globin family. HBG1 makes up the fetal hemoglobin F, in combination with alpha chains. Some gamma variants can cause severe jaundice and cyanosis in premature and new born babies. The antibody is specific to HBG1 and HBG2. The antibody has no cross reaction to HBB and HBD. HBG1 protein migrates around 16 kDa. Heterodimer of 32 kDa may also be observed. This antibody could identify HBG1 and HBG2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag22776 Product name: Recombinant human HBG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC010913 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIH Predict reactive species Full Name: hemoglobin, gamma A Calculated Molecular Weight: 147 aa, 16 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC010913 Gene Symbol: HBG1 Gene ID (NCBI): 3047 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P69891 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.