Proteintech, 86879-3-RR, HBZ Recombinant monoclonal antibody

Size: 20ul / 100ul The HBZ (86879-3-RR) by Proteintech is a Recombinant antibody targeting HBZ in WB, IF/ICC, ELISA applications with reactivity to human samples 86879-3-RR targets HBZ in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HBZ, also named as Zeta-globin and HBAZ, belongs to the globin family. HBZ is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. HBZ was first identified as an antisense viral protein that associated with cAMP-response element binding protein-2 (CREB-2) in HTLV-1-infected cells. HBZ is the only viral gene that is expressed in all ATL cases (PMID: 22787458). ShRNA repression of HBZ expression in established HTLV-1-transformed cell lines and newly immortalized T-lymphocytes also significantly suppressed T-lymphocyte proliferation (PMID: 19650892, 16917009). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11061 Product name: Recombinant human HBZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC027892 Sequence: MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR Predict reactive species Full Name: hemoglobin, zeta Calculated Molecular Weight: 142 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC027892 Gene Symbol: HBZ Gene ID (NCBI): 3050 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02008 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.