Iright
BRAND / VENDOR: Proteintech

Proteintech, 86885-1-RR, FCRL1 Recombinant monoclonal antibody

CATALOG NUMBER: 86885-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FCRL1 (86885-1-RR) by Proteintech is a Recombinant antibody targeting FCRL1 in WB, ELISA applications with reactivity to human samples 86885-1-RR targets FCRL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Transfected with Human FCRL1 (CD307a) CHO cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Fc receptor-like protein 1 (FCRL1) is a type I transmembrane glycoprotein that plays a crucial role in regulating B-cell receptor (BCR)-mediated signaling responses (PMID:15479727). It contains intracellular tyrosine-based motifs that can modulate BCR signaling, leading to changes in calcium flux, proliferation, and antibody production (PMID: 37822931). FCRL1 is involved in regulating B-cell development and activation, with its signaling pathways influencing ERK activation through interactions with proteins such as GRB2. This regulation is essential for maintaining B-cell homeostasis and preventing the development of autoreactive B cells (PMID: 34697226). Since the recombinant protein carries a C-rFc tag, the Western blot result shows a band around 75 kDa. The 60 kDa band is a degradation band. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3713 Product name: Recombinant Human FCRL1 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 17-307 aa of BC033690 Sequence: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNHLTS Predict reactive species Full Name: Fc receptor-like 1 Calculated Molecular Weight: 429 aa, 47 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC033690 Gene Symbol: FCRL1 Gene ID (NCBI): 115350 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96LA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924