Iright
BRAND / VENDOR: Proteintech

Proteintech, 86886-1-RR, DcR1/TNFRSF10C Recombinant monoclonal antibody

CATALOG NUMBER: 86886-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DcR1/TNFRSF10C (86886-1-RR) by Proteintech is a Recombinant antibody targeting DcR1/TNFRSF10C in WB, ELISA applications with reactivity to human samples 86886-1-RR targets DcR1/TNFRSF10C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: JAR cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Decoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4/TRAIL-R1 and DR5/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and/or unusual structural motifs (PMID: 9373179). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4677 Product name: recombinant human TRAIL R3/TNFRSF10C protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 26-235 aa of NM_003841.5 Sequence: ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTP Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: NM_003841.5 Gene Symbol: DcR1 Gene ID (NCBI): 8794 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924