Iright
BRAND / VENDOR: Proteintech

Proteintech, 86917-1-RR, KAT2B/PCAF Recombinant monoclonal antibody

CATALOG NUMBER: 86917-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The KAT2B/PCAF (86917-1-RR) by Proteintech is a Recombinant antibody targeting KAT2B/PCAF in WB, ELISA applications with reactivity to human samples 86917-1-RR targets KAT2B/PCAF in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30238 Product name: Recombinant human KAT2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 366-424 aa of BC060823 Sequence: DQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEAN Predict reactive species Full Name: K(lysine) acetyltransferase 2B Calculated Molecular Weight: 93 kDa Observed Molecular Weight: 93 kDa GenBank Accession Number: BC060823 Gene Symbol: PCAF/KAT2B Gene ID (NCBI): 8850 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924