Proteintech, 86918-1-RR, GMPR 1/2 Recombinant monoclonal antibody

Size: 20ul / 100ul The GMPR 1/2 (86918-1-RR) by Proteintech is a Recombinant antibody targeting GMPR 1/2 in WB, ELISA applications with reactivity to human, mouse, rat samples 86918-1-RR targets GMPR 1/2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue, mouse skin tissue, rat skin tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GMPR (Guanosine monophosphate reductase) catalyzes the irreversible NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). GMPR is able to convert guanosine nucleotides to the pivotal precursor of both guanine (G) and adenine (A) nucleotides. It plays an important role in maintaining the intracellular balance of A and G nucleotides. This antibody can recognize both GMPR1 and GMPR2 due to the high homology. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8185 Product name: Recombinant human GMPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-345 aa of BC008281 Sequence: MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVIERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS Predict reactive species Full Name: guanosine monophosphate reductase Calculated Molecular Weight: 345 aa, 37 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC008281 Gene Symbol: GMPR Gene ID (NCBI): 2766 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36959 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.