Iright
BRAND / VENDOR: Proteintech

Proteintech, 86922-1-RR, GFRA2 Recombinant monoclonal antibody

CATALOG NUMBER: 86922-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GFRA2 (86922-1-RR) by Proteintech is a Recombinant antibody targeting GFRA2 in WB, ELISA applications with reactivity to human samples 86922-1-RR targets GFRA2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information GFRA2, also named as GDNFRB, RETL2 and TRNR2, belongs to the GDNFR family. It is a receptor for neurturin. GFRA2 mediates the NRTN-induced autophosphorylation and activation of the RET receptor. It is a potent survival factor for central dopaminergic neurons, motor neurons, and several other populations of neurons in the central and peripheral nervous systems. The GDNF signal is mediated by a complex of the receptor tyrosine kinase RET and a glycosylphosphatidylinositol (GPI)-linked protein, GDNFRA. GFRA2 has three isoforms with MW 34-36 kDa, 39-41 kDa and 50-55 kDa. This antibody recognizes 50-55 kDa isoform. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4064 Product name: Recombinant Human GFRA2 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-444 aa of BC041688 Sequence: SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPS Predict reactive species Full Name: GDNF family receptor alpha 2 Calculated Molecular Weight: 464 aa, 52 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC041688 Gene Symbol: GFRA2 Gene ID (NCBI): 2675 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00451 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924