Iright
BRAND / VENDOR: Proteintech

Proteintech, 86925-1-RR, MER34 Recombinant monoclonal antibody

CATALOG NUMBER: 86925-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MER34 (86925-1-RR) by Proteintech is a Recombinant antibody targeting MER34 in WB, ELISA applications with reactivity to human, mouse, rat samples 86925-1-RR targets MER34 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, mouse lung tissue, SW480 cells, HCT 116 cells, Caco-2 cells, mouse colon tissue, rat colon tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ERVMER34 (also known as ERVMER34-1) is a human endogenous retrovirus (ERV) envelope protein that has attracted much attention in tumor immunotherapy research in recent years. It is significantly highly expressed in a variety of solid tumors, including colorectal cancer, bladder cancer, lung cancer, breast cancer, and endometrial cancer. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6066 Product name: Recombinant human MER34 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-488 aa of NM_001242690.2 Sequence: LLAPVFRTLSILTNQSNCWLCEHLDNAEQPELVFVPASASTWWTYSGQWMYERVWYPQAEVQNHSTSSYRKVTWHWEASMEAQGLSFAQVRLLEGNFSLCVENKNGSGPFLGNIPKQYCNQILWFDSTDGTFMPSIDVTNESRNDDDDTSVCLGTRQCSWFAGCTNRTWNSSAVPLIGLPNTQDYKWVDRNSGLTWSGNDTCLYSCQNQTKGLLYQLFRNLFCSYGLTEAHGKWRCADASITNDKGHDGHRTPTWWLTGSNLTLSVNNSGLFFLCGNGVYKGFPPKWSGRCGLGYLVPSLTRYLTLNASQITNLRSFIHKVTPHRCTQGDTDNPPLYCNPKDNSTIRALFPSLGTYDLEKAILNISKAMEQEFSATKQTLEAHQSKVSSLASASRKDHVLDIPTTQRQTACGTVGKQCCLYINYSEEIKSNIQRLHEASENLKNVPLLDWQGIFAKVGDWFR Predict reactive species Full Name: endogenous retrovirus group MER34 member 1, envelope Calculated Molecular Weight: 64 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: NM_001242690.2 Gene Symbol: ERVMER34-1 Gene ID (NCBI): 100288413 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H9K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924