Proteintech, 86931-1-RR, MLKL Recombinant monoclonal antibody

Size: 20ul / 100ul The MLKL (86931-1-RR) by Proteintech is a Recombinant antibody targeting MLKL in WB, IF/ICC, ELISA applications with reactivity to mouse samples 86931-1-RR targets MLKL in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: L-929 cells, 4T1 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Mixed lineage kinase domain like pseudokinase (MLKL), belongs to the protein kinase superfamily, has two MW of 54 and 30 kDa. MLKL plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in necroptosis pathway. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32514 Product name: Recombinant mouse Mlkl protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_001310613 Sequence: MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFSKKSHIWKFVSVGNDKILFHEVNEKLRDVWEELLLLLQVYHWNTVSDVSQPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSLKPTQEIPQDLQIKEIPKEHLGPPWTKLKT Predict reactive species Full Name: mixed lineage kinase domain-like Calculated Molecular Weight: 54kd Observed Molecular Weight: 54 kDa GenBank Accession Number: NM_001310613 Gene Symbol: Mlkl Gene ID (NCBI): 74568 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9D2Y4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.