Iright
BRAND / VENDOR: Proteintech

Proteintech, 86941-1-RR, FCRL4 Recombinant monoclonal antibody

CATALOG NUMBER: 86941-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The FCRL4 (86941-1-RR) by Proteintech is a Recombinant antibody targeting FCRL4 in WB, ELISA applications with reactivity to human, mouse samples 86941-1-RR targets FCRL4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Raji cells, K-562 cells, HL-60 cells, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Fc receptor-like (FCRL) 4 is an immunoregulatory receptor expressed on a subpopulation of human memory B cells of mucosa-associated lymphoid tissue. Fc receptor function of FCRL4 was demonstrated by binding of IgA to FCRL4 following heat aggregation of the Ig (PMID: 32513851). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4749 Product name: recombinant human FCRL4 protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 190-384 aa of NM_031282.2 Sequence: FPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNR Predict reactive species Full Name: Fc receptor-like 4 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: NM_031282.2 Gene Symbol: FCRL4 Gene ID (NCBI): 83417 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96PJ5-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924