Iright
BRAND / VENDOR: Proteintech

Proteintech, 86970-1-RR, KIF7 Recombinant monoclonal antibody

CATALOG NUMBER: 86970-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The KIF7 (86970-1-RR) by Proteintech is a Recombinant antibody targeting KIF7 in WB, ELISA applications with reactivity to human samples 86970-1-RR targets KIF7 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, PC-3 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information KIF7(Kinesin family member 7) is a microtubule interacting protein that functions to regulate Hh signaling by maintaining the architecture of the primary cilium, a complex microtubule-based organelle with many signal transduction functions (PMID: 26439735). KIF7 has been shown to have both negative and positive roles in Shh signal transduction. Without a ligand, KIF7 localizes to the cilium base where it forms a complex with Gli proteins and other pathway components and promotes the processing of GliRs (PMID: 21552264). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19119 Product name: Recombinant human KIF7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1214-1332 aa of BC112271 Sequence: VNAVGHSRGGEKRSLCSEGRQAPGNEDELHLAPELLWLSPLTEGAPRTREETRDLVHAPLPLTWKRSSLCGEEQGSPEELRQREAAEPLVGRVLPVGEAGLPWNFGPLSKPRRELRRAS Predict reactive species Full Name: kinesin family member 7 Calculated Molecular Weight: 1343 aa, 151 kDa Observed Molecular Weight: 150, 170 kDa GenBank Accession Number: BC112271 Gene Symbol: KIF7 Gene ID (NCBI): 374654 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q2M1P5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924