Iright
BRAND / VENDOR: Proteintech

Proteintech, 86972-1-RR, TIP30 Recombinant monoclonal antibody

CATALOG NUMBER: 86972-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TIP30 (86972-1-RR) by Proteintech is a Recombinant antibody targeting TIP30 in WB, ELISA applications with reactivity to human samples 86972-1-RR targets TIP30 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, A549 cells, SW 1990 cells, A-673 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TIP30, namely HTATIP2 or CC3, was firstly discovered in small cell lung carcinoma, using differential analyses between highly metastatic human variant cells and less metastatic classic cells.TIP30 was found to be downregulated in various tumors and is considered to be a tumor suppressor due to its pro-apoptotic activity and its anti-metastatic and anti-angiogenic capacities. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0353 Product name: Recombinant human TIP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-276 aa of BC002439 Sequence: TLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPGEWLVRKFFGSLPDSWARGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSLKP Predict reactive species Full Name: HIV-1 Tat interactive protein 2, 30kDa Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 28 kDa, 32 kDa GenBank Accession Number: BC002439 Gene Symbol: TIP30 Gene ID (NCBI): 10553 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BUP3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924