Iright
BRAND / VENDOR: Proteintech

Proteintech, 87013-1-RR, PSMB9 Recombinant monoclonal antibody

CATALOG NUMBER: 87013-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PSMB9 (87013-1-RR) by Proteintech is a Recombinant antibody targeting PSMB9 in WB, ELISA applications with reactivity to human, mouse, rat samples 87013-1-RR targets PSMB9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, Ramos cells, Daudi cells, Raji cells, mouse spleen tissue, rat spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is an essential component of the cellular protein degradation machinery . It can be isolated as a 20 S particle containing more than 15 different subunits ranging in molecular masses from 20-35 kDa. The proteasome can also be isolated as part of a higher molecular mass particle of 26 S which has been shown to rapidly degrade both ubiquitinated and nonubiquitinated proteins in a ATP-dependent fashion. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. (PMID: 1429565) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6048 Product name: Recombinant human PSMB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC065513 Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC065513 Gene Symbol: PSMB9 Gene ID (NCBI): 5698 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924