Iright
BRAND / VENDOR: Proteintech

Proteintech, 87046-1-RR, RRN3 Recombinant monoclonal antibody

CATALOG NUMBER: 87046-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RRN3 (87046-1-RR) by Proteintech is a Recombinant antibody targeting RRN3 in WB, ELISA applications with reactivity to human, mouse samples 87046-1-RR targets RRN3 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RRN3, also known as transcription initiation factor IA, is a key regulatory protein essential for RNA polymerase I-mediated ribosomal DNA transcription. It functions as a bridge molecule that precisely regulates the recruitment of RNA polymerase I to the rDNA promoter and the assembly of the transcription initiation complex by integrating intra- and extracellular signals (such as growth factors, nutrient status, and cellular stress). The activity of RRN3 is tightly controlled by multiple signaling pathways. Specifically, the mTOR and MAPK pathways can activate RRN3 through phosphorylation, thereby promoting ribosomal RNA synthesis and ultimately influencing cell growth and proliferation. Studies have shown that RRN3 is abnormally highly expressed in various cancer cells and is closely associated with malignant tumor progression, making it a potential therapeutic target for anticancer strategies. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23207 Product name: Recombinant human RRN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-365 aa of BC132688 Sequence: ETATQTCGGTDSTEGLFNMDEDEETEHETKAGPERLDQMVHPVAERLDILMSLVLSYMKDVCYVDGKVDNGKTKDLYRDLINIFDKLLLPTHASCHVQ Predict reactive species Full Name: RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) Observed Molecular Weight: 75 kDa GenBank Accession Number: BC132688 Gene Symbol: RRN3 Gene ID (NCBI): 54700 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NYV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924