Iright
BRAND / VENDOR: Proteintech

Proteintech, 87082-1-RR, PTPMT1 Recombinant monoclonal antibody

CATALOG NUMBER: 87082-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PTPMT1 (87082-1-RR) by Proteintech is a Recombinant antibody targeting PTPMT1 in WB, ELISA applications with reactivity to human, mouse, rat samples 87082-1-RR targets PTPMT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, PANC-1 cells, HEK-293 cells, HepG2 cells, HuH-7 cells, mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Protein Tyrosine Phosphatase localized to the Mitochondrial 1 (PTPMT1) is a highly conserved, dual-specific phosphatase that resides on the matrix-facing side of the inner mitochondrial membrane (IMM). PTPMT1 is a mitochondrial phosphatase and a vital regulator of mitochondrial activities. Current work points to roles for PTPMT1 in the regulation of mitochondrial respiration, dynamics, and ultrastructure through the modulation of pyruvate importation, the tuning of TCA cycle activity, and the synthesis of cardiolipin. PTPMT1 is highly expressed in pancreatic b cells, whose mitochondria have the important function of coupling glucose metabolism to the secretion of insulin. (PMID: 16337125, PMID: 16061174, PMID: 33335799) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2063 Product name: Recombinant human PTPMT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC020242 Sequence: MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT Predict reactive species Full Name: protein tyrosine phosphatase, mitochondrial 1 Calculated Molecular Weight: 201 aa, 23 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC020242 Gene Symbol: PTPMT1 Gene ID (NCBI): 114971 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WUK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924