Iright
BRAND / VENDOR: Proteintech

Proteintech, 87093-1-RR, HN1L Recombinant monoclonal antibody

CATALOG NUMBER: 87093-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HN1L (87093-1-RR) by Proteintech is a Recombinant antibody targeting HN1L in WB, ELISA applications with reactivity to human samples 87093-1-RR targets HN1L in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, Jurkat cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Hematological and neurological expressed 1-like protein (HN1L), also known as Jupiter microtubule-associated homolog 2 (JPT2), belongs to the jupiter family. HN1L is nicotinic acid adenine dinucleotide phosphate (NAADP) binding protein required for NAADP-evoked intracellular calcium release (PubMed:33758061). HN1L enables NAADP to activate Ca2+ release from the endoplasmic reticulum through ryanodine receptors (PubMed:33758062). HN1L was also required for the translocation of a severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) pseudovirus through the endolysosomal systemHN1L is expressed in liver, kidney, prostate, testis and uterus (PMID: 15094197). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9400 Product name: Recombinant human HN1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC014438 Sequence: MFQVPDSEGGRAGSRAMKPPGGESSNLFGSPEEATPSSRPNRMASNIFGPTEEPQNIPKRTNPPGGKGSGIFDESTPVQTRQHLNPPGGKTSDIFGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY Predict reactive species Full Name: hematological and neurological expressed 1-like Calculated Molecular Weight: 190 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC014438 Gene Symbol: HN1L Gene ID (NCBI): 90861 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924