Iright
BRAND / VENDOR: Proteintech

Proteintech, 87095-1-RR, GPR37 Recombinant monoclonal antibody

CATALOG NUMBER: 87095-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GPR37 (87095-1-RR) by Proteintech is a Recombinant antibody targeting GPR37 in WB, ELISA applications with reactivity to human samples 87095-1-RR targets GPR37 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). This antibody recognizes endogenous GPR37, which migrates as an approximately 50-55 kDa band in SDS-PAGE (PMID:17519329). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5426 Product name: Recombinant human GPR37 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 27-265 aa of NM_005302.5 Sequence: ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM Predict reactive species Full Name: G protein-coupled receptor 37 (endothelin receptor type B-like) Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: NM_005302.5 Gene Symbol: GPR37 Gene ID (NCBI): 2861 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15354 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924