Iright
BRAND / VENDOR: Proteintech

Proteintech, 87155-1-RR, PPP6C Recombinant monoclonal antibody

CATALOG NUMBER: 87155-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PPP6C (87155-1-RR) by Proteintech is a Recombinant antibody targeting PPP6C in WB, ELISA applications with reactivity to human, mouse, rat samples 87155-1-RR targets PPP6C in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HEK-293T cells, Jurkat cells, NIH/3T3 cells, mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PPP6C (Protein Phosphatase 6 Catalytic Subunit or simply PP6) is a highly conserved serine/threonine phosphatase belonging to the PP2A-like subfamily. This enzyme complex plays critical roles in a wide array of fundamental cellular processes, including cell cycle progression, DNA damage response, NF-κB signaling, and microtubule organization. PPP6C mutations are found across multiple cancer types but are most common in melanoma and other skin cancers (PMID: 33789117). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8554 Product name: Recombinant human PPP6C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-305 aa of BC006990 Sequence: MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTREPKLFRAVPDSERVIPPRTTTPYFL Predict reactive species Full Name: protein phosphatase 6, catalytic subunit Calculated Molecular Weight: 305 aa, 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC006990 Gene Symbol: PPP6C Gene ID (NCBI): 5537 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00743 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924