Proteintech, 87170-3-RR, BLNK Recombinant monoclonal antibody

Size: 20ul / 100ul The BLNK (87170-3-RR) by Proteintech is a Recombinant antibody targeting BLNK in WB, ELISA applications with reactivity to human samples 87170-3-RR targets BLNK in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, Sp2/0 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information BLNK is a cytoplasmic linker or adaptor protein that plays a critical role in B cell development. This protein bridges B cell receptor-associated kinase activation with downstream signaling pathways, thereby affecting various biological functions. The phosphorylation of five tyrosine residues is necessary for this protein to nucleate distinct signaling effectors following B cell receptor activation. Mutations in this gene cause hypoglobulinemia and absent B cells, a disease in which the pro- to pre-B-cell transition is developmentally blocked. Deficiency in this protein has also been shown in some cases of pre-B acute lymphoblastic leukemia. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg6610 Product name: Recombinant Human BLNK protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 330-456 aa of NM_013314.4 Sequence: SNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS Predict reactive species Full Name: B-cell linker Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 68-70 kDa GenBank Accession Number: NM_013314.4 Gene Symbol: BLNK Gene ID (NCBI): 29760 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8WV28-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.