Iright
BRAND / VENDOR: Proteintech

Proteintech, 87183-1-RR, TMX2 Recombinant monoclonal antibody

CATALOG NUMBER: 87183-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TMX2 (87183-1-RR) by Proteintech is a Recombinant antibody targeting TMX2 in WB, ELISA applications with reactivity to human samples 87183-1-RR targets TMX2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HuH-7 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Thioredoxin-related transmembrane proteins (TMXs) are protein disulfide isomerase (PDI) family members and possess a transmembrane region. TMX2 cDNA was first isolated in 2003, and TMX2 mRNA has been found in a variety of human tissues, with the highest levels in the heart, brain, liver, kidney, and pancreas. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13828 Product name: Recombinant human TMX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-296 aa of BC000666 Sequence: PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK Predict reactive species Full Name: thioredoxin-related transmembrane protein 2 Calculated Molecular Weight: 296 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC000666 Gene Symbol: TMX2 Gene ID (NCBI): 51075 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y320 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924