Iright
BRAND / VENDOR: Proteintech

Proteintech, 87187-3-RR, CLPP Recombinant monoclonal antibody

CATALOG NUMBER: 87187-3-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CLPP (87187-3-RR) by Proteintech is a Recombinant antibody targeting CLPP in WB, ELISA applications with reactivity to human, mouse, rat samples 87187-3-RR targets CLPP in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, A549 cells, Saos-2 cells. A431 cells, K-562 cells, mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8325 Product name: Recombinant human CLPP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC002956 Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST Predict reactive species Full Name: ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC002956 Gene Symbol: CLPP Gene ID (NCBI): 8192 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16740 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924