Iright
BRAND / VENDOR: Proteintech

Proteintech, 87230-1-RR, IL-11 Recombinant monoclonal antibody

CATALOG NUMBER: 87230-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The IL-11 (87230-1-RR) by Proteintech is a Recombinant antibody targeting IL-11 in WB, ELISA applications with reactivity to mouse, rat samples 87230-1-RR targets IL-11 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: rat plasma, rat serum Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IL-11 is a member of the interleukin family of cytokines. It was discovered in the late 20th century as researchers were exploring various cytokines involved in immune responses and cell growth regulation. IL-11 has significant effects on hematopoietic cells. It can stimulate the proliferation and differentiation of megakaryocytes, which are the precursors of platelets. This action helps in the regulation of platelet production. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2935 Product name: recombinant mouse Il11 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-199 aa of NM_008350.4 Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL Predict reactive species Full Name: interleukin 11 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_008350.4 Gene Symbol: Il11 Gene ID (NCBI): 16156 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P47873 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924