Proteintech, 87253-1-RR, NEK7 Recombinant monoclonal antibody

Size: 20ul / 100ul The NEK7 (87253-1-RR) by Proteintech is a Recombinant antibody targeting NEK7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 87253-1-RR targets NEK7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, NIH/3T3 cells, C6 cells, RAW 264.7 cells Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Mammalian NIMA-related kinases (NEKs) represent a family of serine/threonine kinases, named NEK1-NEK11, which are implicated in the control of several aspects of mitosis and are involved in non-mitotic functions (PMID: 33364979). NIMA-related kinase 7 (NEK7) is the smallest NIMA-related kinase (NEK) in mammals. NEK7 is identified as a highly conserved serine or threonine kinase, which is not only crucial for mitosis entry, cell cycle progression, cell division, and mitotic process, but also expressed in brain, heart, lung, liver, spleen, and other issues (PMID: 31787755). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33629 Product name: Recombinant human NEK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-36 aa of NM_133494 Sequence: MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRI Predict reactive species Full Name: NIMA (never in mitosis gene a)-related kinase 7 Calculated Molecular Weight: 35 Observed Molecular Weight: 32-35 kDa GenBank Accession Number: NM_133494 Gene Symbol: NEK7 Gene ID (NCBI): 140609 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TDX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.